PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011073899.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family FAR1
Protein Properties Length: 231aa    MW: 26604.4 Da    PI: 9.4123
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011073899.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR164.33.4e-2065150290
            FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                     +Y+eYA ++GF +r+ +s+ks+r+g+ ++r + C +  + +++ +    +++tr++ r gC+a+l vkke+ g+w v k++ +HnH+l+
  XP_011073899.1  65 YYEEYAGRAGFLTRVLSSRKSERDGSLISRGLGCRNILHVQKSGSL---SNETREKRRDGCTAMLLVKKESAGRWIVRKFVRDHNHPLV 150
                     8*********************************999888888776...8899999*******************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031015.3E-1865150IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MTKCHDWADV MQHFLPVDVE DRLDGGGKEM IEASVMADLT SCEVDRKGEP YEGMIFETEA  60
AARAYYEEYA GRAGFLTRVL SSRKSERDGS LISRGLGCRN ILHVQKSGSL SNETREKRRD  120
GCTAMLLVKK ESAGRWIVRK FVRDHNHPLV VSLPKRRPTF DEKDKRIQEL TAELRVKKRL  180
SSAYREQLLI LMKDVENHND HLTSKVQIIR NNLKELEARR QELLNHNKPS S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011073899.11e-172PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1 isoform X1
RefseqXP_011073900.11e-172PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1 isoform X1
RefseqXP_011073901.11e-172PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1 isoform X1
TrEMBLA0A022RAG61e-119A0A022RAG6_ERYGU; Uncharacterized protein
STRINGSolyc06g073210.2.13e-96(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA130991718
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43280.13e-47FAR1 family protein